General Information

  • ID:  hor005471
  • Uniprot ID:  P21624
  • Protein name:  urotensin I
  • Gene name:  NA
  • Organism:  Platichthys flesus (European flounder) (Pleuronectes flesus)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Platichthys (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SEDPPMSIDLTFHMLRNMIHMAKMEGEREQAQINRNLLDEV
  • Length:  41
  • Propeptide:  AAAAGDSAASDLLGDNILRSEDPPMSIDLTFHMLRNMIHMAKMEGEREQAQINRNLLDEV
  • Signal peptide:  NA
  • Modification:  T41 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  It has a suggested role in osmoregulation and as a corticotropin-releasing factor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P21624-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005471_AF2.pdbhor005471_ESM.pdb

Physical Information

Mass: 555521 Formula: C204H332N60O66S5
Absent amino acids: CWY Common amino acids: EM
pI: 4.53 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 11
Hydrophobicity: -64.39 Boman Index: -10244
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.54
Instability Index: 6328.29 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2284199
  • Title:  Urotensin I and its N-terminal flanking peptide from the flounder, Platichthys flesus.